Statigram has now become Iconosquare! Learn more
martina_bee
This should happen more often c: #cereal #surprise #toy #bela #childhood #exitment #kellogs
toy - exitment - cereal - kellogs - surprise - bela - childhood -
kay_caruanaxx -
instagram
samuelrollarella
Opened a fruit winder... there were 2 inside. Little things like this♡ #Luck #Happy #Kellogs #Fruit #Winder
happy - fruit - winder - kellogs - luck -
amyylouuuu - imanandbhutiya - xrusa_deskou - samanthahampson -
instagram
plymouth_jones
What's your cereal day? #tbt #IWasPissedWhenMyCerealDidntTalk #90s #commerical #kellogs #ricekrispies
90s - iwaspissedwhenmycerealdidnttalk - kellogs - commerical - tbt - ricekrispies -
kendawg_ : 😂😂😂😂😂😂😂😂
ash8887 : I just died laughing oh my god.
bobbysiegworth91 - kendawg_ -
instagram
oliviercollignon
Gala du barbou! Gosse beau. #full #swaag #costume #airmax #chemise #trop #laid #lait #cacao #kellogs #frosties #cocopops #mdr #follow #me
me - cocopops - swaag - full - kellogs - lait - chemise - airmax - laid - costume - mdr - follow - cacao - trop - frosties -
inesdeterville : T'es pas assorti a moi, change toi ! @oliviercollignon
oliviercollignon : Je m'en branle de ça! @inesdeterville
manonmignon - luca_difelice -
instagram
bollywood_ishq_
How can someone be sooo adorable and perfect?♥ Anywayz I got my braces today and it feels kinda wierd, I want to take them off but of course its gonna make me look better so gotta spend a year or so wid them :p || Goodnight :) Pic Creds :- @deepikapadukonefanatics #deepikapadukone #kellogs #selfie
selfie - deepikapadukone - kellogs -
mysteri0usgal - mit989 - bollywood_world - bollywood_aashiqui -
instagram
miarcu64
Break #break #fast #fruit #kellogs #food #foodporn #good
break - fruit - good - kellogs - foodporn - food - fast -
laug22 - thedinersdigest -
instagram
elisewin83
24.4.14/pop of colour. #morning #kellogs #cereals #red #fruit #apopofcolour #milk #fatmumslim #fmsphotoaday
apopofcolour - cereals - kellogs - morning - fatmumslim - fruit - fmsphotoaday - milk - red -
josienlucassen : Jumm! 👍
__pupilla__ - maryriguetti - chronicallysickmanicmother - the_cooking_observer -
instagram
mon_diett
Mieux vaut tard que jamais !! Voilà mon petit déj de ce matin ! 1/2 bol de céréales complètes au fruits avec du lait demi écrémé et un kiwi pour prendre des forces 😉 #breakfast #kellogs #petitdejeuner #motivée
breakfast - motivée - kellogs - petitdejeuner -
joseyuf - stayhappy_stayhealthy - guadalupeufp - marcoinvierno -
instagram
alecastels
Se non ci foste voi... #kellogs#cereal#muesli#chocolate#love
muesli - love - cereal - kellogs - chocolate -
_elisapellegrini : Dioo sono i migliori quelli!!
margheritabisagni : No va beh li amo non puoi capire. Anche quelli senza cioccolato però
katycatcat69 - bi_bit - _elisapellegrini - margheritabisagni -
instagram
stepy94
#Yogurt #mirtilli #cereali #specialk #merenda #salute #health #food #fitness #instacollage #fruit #kellogs #yummy
yummy - kellogs - merenda - specialk - instacollage - food - fruit - health - cereali - mirtilli - fitness - yogurt - salute - healtyisbetter -
stepy94 : #healtyisbetter
stepy94 : @healthyisbetter_
boguabba : Superb~
mladymarie - evelynnln - lauricejvp - smoothiedetox -
instagram
woodg31
#DoctorWho #ThrowbackThursday #Tardis #Kellogs #SugarSmacks #Badges #JonPertwee Throwback to the days of free gifts in your breakfast cereal! These really cool pin badges were given away inside packs of Kellog's Sugar Smacks in 1972! Tasty! 👍💥🍜
kellogs - throwbackthursday - doctorwho - sugarsmacks - tardis - badges - jonpertwee -
marybeth_curtis : He is also giving away nightmares. :)
woodg31 : @marybeth_curtis Yes not quite the face you want to see first thing in the morning! More Worzel than Who 😃
comicbook_ads : 👌
woodg31 - comicbook_ads - batmancollection - brianlevant -
instagram
csipete
Is there anyone who can read this? Please enlighten me there is nothing rude or dirty stuff on my new hoodie! #helpme #icannotreadasian #kellogs #read
read - helpme - icannotreadasian - kellogs -
csipete : My english is not so good either! :D
szugyiczki_csabiczki : It says: "Jamaican cock" :)
szugyiczki_csabiczki - annabellss - thebjthomas -
instagram
oh_felix1087
Tbt Christmas or thanksgiving idk #kellogs #kellogsdiarys #meatballTryingToStealHim #hesSmall #tigger #roar #lion
lion - kellogsdiarys - kellogs - roar - hessmall - tigger - meatballtryingtostealhim -
tht_kid_carroll : Dude 13 l
tht_kid_carroll : 13 post less the 24 hours... that's issue's lol
oh_felix1087 : @tht_kid_carroll that's a record n like all 13
gina_teresaa : My puss
oh_felix1087 : @gina_teresaa 🐱👢
rebeccalather - kendallmary - diamondeyez27 - marissa_fawn -
instagram
sleepy_druid
Thought I might share that yesterday I opened a new box of Fruit loops and this was hiding inside. We didn't find it until it was in Jeff's bowl and after we had already ate some. It got everywhere and was absolutely disgusting. Goodbye fruit loops for the rest of my life. #kellogs #fruitloops #disgusting #whatisit
fruitloops - disgusting - kellogs - whatisit -
itskelseybiaatch - karoline_jelly - jewelskk - littlevictoire -
instagram
crazylore
#healthymeal #health #morning #loveit #banana #strawberry #kellogs
strawberry - health - banana - kellogs - loveit - healthymeal - morning -
michelle_ellulx : Follow please! :)
shannon_150 -
instagram
fawziyahxo
#happy :)) #kellogs #poptarts #chocolate #toaster #pastries #inlove
happy - pastries - inlove - poptarts - kellogs - toaster - chocolate -
michelle_ellulx : Follow please! :)
roshnarabibi - rob_ssc - tulisaworld - nel_sa -
instagram
danilooker96
Don't mind if I do.. #poptarts #kellogs #american #sweets #chocolate #tlc #food #treat #film #movie #chill #break #diet #yummy
break - yummy - kellogs - food - movie - diet - chocolate - tlc - sweets - american - treat - chill - film - poptarts -
michelle_ellulx : Follow please! :)
bennydanny : Nice image! (:
nikicampa - doidanoprato - gina_bhakta - bennydanny -
instagram
healthyoftheday
Buongiorno! Colazione con 200ml di latte di riso e un pacchetto di questi biscotti: una confezione ne contiene 4 per un totale di 179kcal. A merenda la solita mela e a pranzo credo mangerò 80g di pasta integrale al pesto.
healthyfood - healthygirl - kellogs - foodporn - food - colazionetime - cleaneating - eatinghealthy - breakfastfood - healthyfoodporn - diet - delicious - breakfast - cleaneats - lifestyle - healthydiet - healthy - biscuits - foodshare - italia - eatclean - healthychoice - health - cleanlifestyle - healthyfoodshare - healthyliving - goodmorning -
healthyoftheday : #colazionetime #breakfastfood #breakfast #biscuits #kellogs #goodmorning #diet #italia #delicious #foodshare #food #foodporn #eatclean #eatinghealthy #cleaneats #cleanlifestyle #cleaneating #lifestyle #healthychoice #healthyliving #healthydiet #health #healthyfoodshare #healthygirl #healthyfood #healthyfoodporn #healthy
michelle_ellulx : Follow please! :)
foodsmile_9 - heavyhealthyfeather - _myexploringlife - soumaiaelbied -
instagram
bshaw557
Quite tasty #poptarts #kellogs #blueberry #raspberry #tea #cuppa
cuppa - poptarts - kellogs - tea - raspberry - blueberry -
kategates_ : Why are you uploading photos of my mum xx calling her penguin ?
bshaw557 : Lolwut @kategates_
michelle_ellulx : Follow please! :)
kinglion - isabellesingleton - finding_vickiness - cottingtoncris -
instagram
slickromney
My all time fav. #Kellogs #SimpleGrain #Breakfsst
breakfsst - simplegrain - kellogs -
michelle_ellulx : Follow please! :)
lovemechee_ : Ewwww cereal nasty
slickromney : @lovemechee_ you don't know what your missing
lovemechee_ : I do kno
dluvmyselfjames - rc9203 - lovelydani28 - ms_changed4_dabetter -
instagram
sabinanoordzij
Oh my a #questbar #coconut And a #chocolate biscuit 🙈🙉🙊💜✨. Oh yea Thanks to #flexibledieting #iifym . Just did Some tabata to speed up my metabolism burn baby burn💕💪 #quark#blueberries#kellogs#macros #macrocounting #reversedieting #protein #proteinbar #proteinpowder #health #healthy #healthyfood #healthysnack #healthyeating #postworkoutfood#food #foodporn #nutrition
healthyfood - nutrition - coconut - fitspo - kellogs - foodporn - food - proteinbar - quark - eattogrow - eatforabs - protein - chocolate - healthyeating - fitfam - macrocounting - blueberries - proteinpowder - healthy - macros - reversedieting - iifym - health - flexibledieting - postworkoutfood - questbar - healthysnack -
sabinanoordzij : #fitfam #fitspo #eatforabs #eattogrow
lakemelissa : 😍
misskellystorum - dionne_vg - iifymfood - johnnymac24 -
instagram
michelle_ellulx
Snack/lunch thing #amazing#yummy#special#k#kellogs#biscuitmomrnts#yay#happy#girl#chocolate#delicious
yummy - kellogs - k - chocolate - amazing - delicious - yay - girl - happy - special - biscuitmomrnts -
lauren_gatt - inglizaaa - lexi4445 - juliabeacom -
instagram
andruschkka
#late#good#morning#cantaloupe#kellogs#hafer#flakes#bananas#milky#love
cantaloupe - good - love - bananas - kellogs - morning - late - hafer - flakes - milky -
tonyheathcliff -
instagram
aaronsingh09
#breakfast #kellogs #RiceKrispies #Arrow #FavouriteSeries
favouriteseries - breakfast - ricekrispies - kellogs - arrow -
terraturner - gettingfitdone - falmasri - karolajna_ -
instagram
jammiesx
#goodmorning #morning #breakfast #kellogs #food #foodporn #holiday #hotel #titanicdeluxe #titanic #belek #instagood #instamood #l4l #likeforlike #like4like #relax #s4s #spamforspam #spam4spam #summerfeeling #sunshine #turkey #turkish
sunshine - kellogs - foodporn - food - spam4spam - hotel - breakfast - instagood - turkey - titanicdeluxe - like4like - spamforspam - turkish - relax - titanic - morning - belek - likeforlike - s4s - holiday - summerfeeling - instamood - goodmorning - l4l -
dorinesnoek : Fuck you😲😘😘
jammiesx : @dorinesnoek 't eten lust ik toch niet hier, behalve brood en kellog's en pasta, t lijkt lekkerder dan t eruit ziet!! Geloof me!
dorinesnoek : Ohw hahahaha noujaaa boeiee xx alsof ben ik jaloers😊😊
jammiesx : @dorinesnoek ❤️
_famousfreak : Nice photo :) Follow for follow?
anoukjeverhorik - selientjehh_xo - glenn0475 - fabienne_bos -
instagram
julyxdecember
In case you couldn't already tell... Now you know: #peanutbutterobsessed #peanutbutterftw #peanutbutter #peanutbuttereverything #reeses #kellogs #poptarts #chocolate 🙈💕 so... that's basically it. 🍪🍩
reeses - kellogs - peanutbuttereverything - peanutbutterftw - chocolate - peanutbutter - peanutbutterobsessed - poptarts -
maisy_is_very_crazy - healthyfoodskinny - aguaiani - nel_sa -
instagram
nurizaothman
#emartleeling #emart #shopping #groceries #milo #nestle #kokokrunch #frosties #kellogs This very afternoon
kokokrunch - shopping - kellogs - emart - nestle - groceries - milo - emartleeling - frosties -
simplycheaper -
instagram
avenueillustratedspain
Nueva colección de bañadores kellogs, este año con la colaboración de @laurasanchez y su firma bloomers& bikini #specialk #kellogs
specialk - kellogs -
avenueillustratedspain - klaramorante -
instagram
sheengrantmatee
Breakfast on the run...feel like a little kid💖🙈 #CocoPops #Breakfast #Kellogs
cocopops - breakfast - kellogs -
anniedarlynx - gorohek - amrbebo28 - mgahd94 -
instagram
thebigbangtheory_geeks
I just found them yesterday at the super market😂 - OMG😂😂😂😂HOWARD So funny ,I can't believe I found them here in Germany :o - By the way ,THEY ARE DELICIOUS❤️ - #frootloops#kellogs#delicious#yummy#howard#wolowitz#howardwolowitz#simon#helberg#simonhelberg#cool#astronaut#tbbt#bbt#bigbangtheory#thebigbangtheory
frootloops - kellogs - thebigbangtheory - helberg - delicious - bbt - cool - simon - yummy - howard - bigbangtheory - simonhelberg - howardwolowitz - tbbt - astronaut - wolowitz -
jimparsons_fan : Ill have to ask me mum to get me a pot or something just so I can taste then with sugar, when we got them the first time, they were disgusting, but thats because there was no sugar, I think and hope
thebigbangtheory_geeks : :D Believe me ,THEY ARE LOVELY WITH SUGAR ❤️ @jimparsons_fan
jimparsons_fan : Awww thanks @thebigbangtheory_geeks ill have to get a little pot of it <3
kelloggsus - sergiocantoreggi - mandi042392 - the_bigbangtheoryfans -
instagram
sincerelyalfie
I guess breakfast is sorted 😏🙈 #poptarts #smores #yummy #food #breakfast #fatty #instafood #kellogs
yummy - fatty - kellogs - food - instafood - poptarts - smores - breakfast -
heartandstomach : Aww yeah 😊
sammy_johnst - emmapomphrey - olsendenise - allenhiggin -
instagram
angelsbest1819
#kellogs #ricekrispies can't resist
ricekrispies - kellogs -
instagram
luceral
Hoy desayuno mis All-Bran de #Kellogs para cargarme de energy para su desfile de baño de Special K. Aunque llueva ya huele a verano! Feliz jueves!! 💙💙❤️❤️@pinupshowroom
specialkattitudes - kellogs -
luceral : #specialkattitudes
crissvaldes : Feliz jueves preciosa
agostinasaracco : Voy para allá mi @luceral 🙌🙌🙌🙌🙌
luceral : @agostinasaracco aqui estooooy jjijiji en primera fila a la izquierda ok??
ibontxu4 - alsuct - paula82st - paulaposadilla_ -
instagram
Iconosquare feedback