duhyunc
어느덧 일년! Miss the boyz and good times! #soldiers #military #beret #uniform #sergeant #discharge #fit #follow #comrades #제대 #군인 #군대 #병장
summer - 분대장 - follow4follow - 맞팔 - beret - 군대 - 소통 - soldiers - 얼스타그램 - 제대 - discharge - follow - 병장 - 여름 - fit - followforfollow - 군스타그램 - 군인 - followall - uniform - 일년 - 베레모 - sergeant - f4f - comrades - military - followme -
duhyunc : #followme #summer #followall #followforfollow #follow4follow #f4f #얼스타그램 #군스타그램 #일년 #분대장 #맞팔 #여름 #베레모 #소통
kika_cj96 - jungju_92 - jarodrick - hgg4811 -
instagram
astrid419
I want to wish this BADASS a Happy Birthday 💕 although we have been apart for years you will always be my best friend 👭 I am extremely proud of the tough ass woman you've become 👊 Te Quiero Mucho! Feliz Cumpleaños aunque estemos tan lejos siempre seras mi mejor Amiga es un orgullo decir que eres mi Hermana 💗 #hbd #littlesis #toughasschick #sergeant #USAirforce #MP #sexymilitarygirl 🎉💝🎂
mp - littlesis - hbd - sexymilitarygirl - usairforce - toughasschick - sergeant -
misfitrosee - fnkcoco - deejaynemesis - ljwrighty -
instagram
elrambochapin
Con el #sergeant #elgringo #friend
sergeant - friend - elgringo -
dayis_arriola - maumadrigales - jackelinne_cuevas - fabiishaw -
instagram
aaronjaay
Good night everyone. #beautifulplaces #cityview #citylights #utah #saltlakecity #goodnight #armytraining #aftergymrun #sergeant #sergeantschool #running #nationalguard
armytraining - utah - running - sergeantschool - citylights - nationalguard - goodnight - aftergymrun - cityview - saltlakecity - beautifulplaces - sergeant -
devmtn - roarr17 - leoaul - elizabethmarymargaret -
instagram
lickyoats
Yo! Freedom
lickyoats - newyork - celebrities - slaughter - sergeantslaughter - filecard - comiccon - javitz - javitzcenter - sarge - gijoe - knowingishalfthebattle - sgtslaughter - sergeant - yojoe - nyc - 2013 -
lickyoats : 2013 Sgt. Slaughter's Booth, NYC Comic Con, Javitz Center, New York, NY (with Sgt. Slaughter)
lickyoats : Jarboe - Yo! Freedom - http://bop.fm/s/jarboe/yo-freedom
lickyoats : #2013 #comiccon #nyc #newyork #javitzcenter #javitz #gijoe #celebrities #sergeantslaughter #sgtslaughter #yojoe #knowingishalfthebattle #lickyoats #filecard #slaughter #sergeant #sarge
lickyoats - sc_tt_darr_h - marfrancewv - sethroark -
instagram
thequeenunderthemountain
Took my soldier to the board. #wetraingods #sergeant #nco #asu #army #usarmy #military #25thid #swag #selfie
swag - asu - army - selfie - usarmy - wetraingods - sergeant - nco - military - 25thid -
blew4u : See, I told you today will be a brighter day! You look good battle! 💁
thequeenunderthemountain : I knoooow @blew4u you know I worry too much. Thanks 😊
hurley429 - alfraziersmith - smileits_nay - the_arroxx -
instagram
svu_hargitay1999
Goodnight my darlings..🌙 • • Sorry I didn't post yesterday, I'm doing so much sweet sixteen planning, it's not even funny, and today I hung out with my boyfriend and we had a great time! I have a pic if y'all wanna see.. Comment below or get me to 15 likes.. And I'll post a pic of us together.(:💕 • • Mariska is such an amazing mother, can she adopt me?👌🙏💕 #mariska #hargitay #mariskahargitay #olivia #benson #oliviabenson #liv #sergeant #4015 #lawandorder #svu #nomore #joyfullivin #joyfulheart #jhf #beautiful #inspire #inspiration #augusthermann
beautiful - joyfullivin - inspire - lawandorder - oliviabenson - olivia - augusthermann - inspiration - benson - joyfulheart - jhf - 4015 - liv - sergeant - mariskahargitay - nomore - hargitay - svu - mariska -
mariskaistheshit - _bella_martinez__ - zee.zeee - trickorbeats -
instagram
miss_elf483
D-6 ~Come Back Leader Leeteuk «3 #Leeteuk #Sergeant #ParkJungSoo #Angel #6Days #Leader #SuperJunior
superjunior - parkjungsoo - sergeant - angel - 6days - leeteuk - leader -
_faaaru89 - luceromasenkim - annbatayan24 - galaxychoiping9 -
instagram
doublerainbow666
LOVE this #movie #fullmetaljacket #vietnam #realdrillSergeant #drillsergeant #sergeant #movies #classic #classicmovie #classics #army #unitedstates #marine #marinecor 1234 UNITED STATES MARINE COR
classicmovie - marinecor - fullmetaljacket - drillsergeant - movie - army - movies - vietnam - classic - sergeant - realdrillsergeant - classics - marine - unitedstates -
svoimxodom : inspiration to travel! comment @svoimxodom
ulyceez - mapleherstad - tumorrison453e - petermahany -
instagram
kevinnnn_gee
I Support The New Founding Fathers of America 🔫💣🔪🔨💵 #ThePurgeAnarchy #Awesome #Sergeant #Shane #Liz #Eva #Cali
cali - thepurgeanarchy - sergeant - shane - eva - awesome - liz -
nutellaaa_cx - bequitaaa_ - cristhian.villegas - ricky_33_arango -
instagram
antlove
Watch the #sergeant get the #troops back in line after celebrating a td.
sergeant - troops -
the_game4 - xanikxs - lk9official -
instagram
beena_bean
mcm - ugh - badbreath - hashtagfornireason - hashtagfornoreason - shameonyou - butitstuesday - soldier - iloveyou - sergeant - justkidding - eww - cantspell - oops -
beena_bean : Eww gross but I still love my #soldier #shameonyou #mcm #butitstuesday that hashtag looks like it has the word tits but it doesn't. #iloveyou #badbreath #eww#justkidding #ugh #sergeant #hashtagfornireason
beena_bean : #hashtagfornoreason #oops #cantspell
bmadrid29 - alyssafotii - austy14 - katielyyyn -
instagram
rhyssaunders3
Best mates #cadets #flightsergeant #sergeant
cadets - flightsergeant - sergeant -
rhyssaunders3 : love her!
livvy_01 - willsherb - chelsealouisemay - livmcewan -
instagram
ins.die
So I just got promoted?! As you can tell Briony's happy for me! #promotion #cadets #sergeant #whatjusthappened
cadets - promotion - sergeant - whatjusthappened -
charlotte_emily_bell : Yes meg 😘
em_r_jones : Ahh! Well done meg! 👏😘
ins.die : Thank you guys!:D @charlotte_emily_bell @em_r_jones
karaaa_b - ccf_1997 - charlotteeeee_xox - jansen_emmery -
instagram
cycopath88
#iggymrat #igfitness #fitness #eatcleantraindirty #beastmode #beast #monster #bodybuilding #weightloss #inspiration #boom #bcaa #mindovermatter #fitandtall #tattoos #gymrat #neverbackdown #bigheart #motivation #army #hooah #sergeant #10thmountain #1stbrigade #warriors #alpha #zerojudgment #faith #musclepharm #workout
tattoos - motivation - musclepharm - faith - workout - eatcleantraindirty - 10thmountain - fitandtall - beast - mindovermatter - bodybuilding - alpha - weightloss - neverbackdown - monster - beastmode - zerojudgment - iggymrat - army - warriors - igfitness - bcaa - hooah - 1stbrigade - sergeant - bigheart - fitness - inspiration - gymrat - boom -
gdzsupplements - allan_chang21 - fitnessfreak84 - adventuresofnewkristine -
instagram
bigsee2014
12 hours of drill is too much for any man #army #training #sergeant #rir #royalirishregiment
sergeant - training - rir - royalirishregiment - army -
idwithlee : Nice! Did you know you can make money posting pics on Instagram? Take a look?
projectgetinshape - freidahenke - aj8asmi1a -
instagram
cycopath88
#iggymrat #igfitness #fitness #eatcleantraindirty #beastmode #beast #monster #bodybuilding #weightloss #inspiration #boom #bcaa #mindovermatter #fitandtall #tattoos #gymrat #neverbackdown #bigheart #motivation #army #hooah #sergeant #10thmountain #1stbrigade #warriors #alpha #zerojudgment #faith #musclepharm #workout
tattoos - motivation - musclepharm - faith - workout - eatcleantraindirty - 10thmountain - fitandtall - beast - mindovermatter - bodybuilding - alpha - weightloss - neverbackdown - monster - beastmode - zerojudgment - iggymrat - army - warriors - igfitness - bcaa - hooah - 1stbrigade - sergeant - bigheart - fitness - inspiration - gymrat - boom -
joeezz48 - toinfinity_and_beyonce - brieanaxo - j_a_fitness32 -
instagram
__linabelle__
MOM!!!! BREAKFAST!!!!!
vonfalconer - germanshepherd - dogsofinstagram - brusselsgriffon - doubletrouble - ilovemydogs - california - petitbrabancon - breakfast - lina - everydayimbrusselin - dogsofig - hungry - griffon - sergeant - topdog - dogoftheday -
blaine_griffon : So cute!
__linabelle__ : #brusselsgriffon #everydayimbrusselin #petitbrabancon #griffon #germanshepherd #dogsofig #dogsofinstagram #dogoftheday #topdog #doubletrouble #vonfalconer #sergeant #lina #ilovemydogs #hungry #breakfast #california
happy_griffon : Look out little friend! There's a hungry wolf behind you! !! 😱
tdotgriffs : 😍
kanaiasuka - elenarijakova - keepinitteal - naz_na -
instagram
kelanijay
Ive got me a great group of men in my family &boyfriend who serve(d) in the miliary, &i couldnt be more greatful for their sacrifice to serve our country. #troopthanks #ripgrandpa #mastersergeant #airforce #pops #sergeant #babybro #pfc #uncle/bro #private #babes #myvetern #specialist #supportourtroops #usarmy
specialist - pfc - airforce - supportourtroops - troopthanks - private - myvetern - usarmy - uncle - sergeant - ripgrandpa - babes - babybro - mastersergeant - pops -
saliamarie1243 - jmartinez5523 - kayyce - shanelleyy_ -
instagram
genx97
#Mesmerizing #Photographs Of #SoldiersFaces #BeforeAndAfter A War #Sergeant #AlexanderMcBroom, #24 While the #emotional #repercussions of war aren't easy to measure, the before, during, and after pictures of #soldiers who have seen #combat tell a pretty #unsettling story. Many times pictures speak louder than stories: by creating a #timelapse #portrait series of soldiers #before, #during and #after the #war, #LalageSnow reveals more about their #psychologicaldrama then their own words could. Titled “#Wearethenotdead”, the portraits show an #8month span in the lives of the #British soldiers that were deployed in #Afghanistan, and the changes in their eventually #weary #faces are #striking.
photographs - after - combat - striking - alexandermcbroom - repercussions - lalagesnow - beforeandafter - weary - soldiersfaces - during - soldiers - portrait - before - 24 - afghanistan - mesmerizing - unsettling - timelapse - british - wearethenotdead - 8month - sergeant - faces - emotional - psychologicaldrama - war -
devinreeseboesing : Amazing
brunette_92 - fitness_god24 - nobullgymwear - naomiamanda08 -
instagram
wonderfulrae33
#Marine#USMC#semperfidelis#devildog#leatherneck #promotion#Sergeant#mySon #myMarine#SergeantofMarines#Love#miss
love - miss - devildog - usmc - semperfidelis - mymarine - sergeantofmarines - leatherneck - myson - promotion - marine - sergeant -
the__marines - candykane001 - xokaysz__ - corpsstrength -
instagram
hiozdogru
Askerlige ogrenci olarak basladim :)
ogrenci - militaryschool - sapka - askeriogrenci - navy - millitaryschool - school - army - 1998 - asker - beyaz - uniform - sergeant - military - white - officer -
hiozdogru : #navy #military #millitaryschool
hiozdogru : #navy #1998 #militaryschool #military #school #officer #sergeant #army #uniform #asker #askeriogrenci #ogrenci #beyaz #sapka #white
okkesyucel - aysglkilinc - dilarakeskiner - dontforgetosmileveryday -
instagram
ashleyg5755
Me and the bae #wewantout #annualcamp2014 #sergeant #lancecorporal #jersh @christopher_robb
lancecorporal - annualcamp2014 - jersh - sergeant - wewantout -
fern_harvey - craigy_ross1 - christopher_robb -
instagram
________tp
#bashbrothers planning their next method for destruction. 😩😘 #riot #sergeant #pitbull #pitbullsofinstagram
pitbull - pitbullsofinstagram - sergeant - riot - bashbrothers -
hailie_richards - laurjankowski - measy197 - britshittt -
instagram
cycopath88
#iggymrat #igfitness #fitness #eatcleantraindirty #beastmode #beast #monster #bodybuilding #weightloss #inspiration #boom #bcaa #mindovermatter #fitandtall #tattoos #gymrat #neverbackdown #bigheart #motivation #army #hooah #sergeant #10thmountain #1stbrigade #warriors #underconstruction #protein #bcaa #insane #exercise
insane - tattoos - motivation - monster - eatcleantraindirty - 10thmountain - fitandtall - beast - mindovermatter - bodybuilding - 1stbrigade - protein - weightloss - neverbackdown - inspiration - beastmode - iggymrat - army - underconstruction - warriors - igfitness - bcaa - hooah - sergeant - bigheart - fitness - gymrat - exercise - boom -
timmyjohn1121 - monicahamaker - dietarydepot - brian_hastings -
instagram
differentkind_ofmeasurement
Partners ❄️ #partners #bensaro #nickamaro #oliviabenson #detective #sergeant #snowflakes #mariskahargitay #dannypino #lawandordersvu #svu
detective - partners - snowflakes - bensaro - dannypino - oliviabenson - sergeant - mariskahargitay - lawandordersvu - svu - nickamaro -
peyton_f - arantzamurillosantin - robinsonnomore1230 - fransfb -
instagram
djleepanda
Lol gross. Why do I have this from 8 years ago. #marine #usmc #wtf #mci #gross #trash #eww #veteran #dd214 #terminallance #sergeant #sgt #e5
terminallance - gross - dd214 - mci - usmc - veteran - sgt - sergeant - wtf - e5 - trash - marine - eww -
b3zang - derealizati0n - ashleymaegan00 - jake_sizzle -
instagram
kkaylarw
his favorite place.. Petsmart lol #sergeant #newf #newfie #newfoundlanddog #instadogs #groomed #lookingood #newfsofinstagram #petsmart #yeg
newfsofinstagram - newf - yeg - newfie - instadogs - groomed - newfoundlanddog - petsmart - lookingood - sergeant -
mewzick - curious__george_ - jdme1 - mackroz -
instagram
differentkind_ofmeasurement
❄️Snowflakes #snowflakes #svu #lawandordersvu #bensaro #partners #mariskahargitay #dannypino #oliviabenson #nickamaro #detective #sergeant
detective - partners - snowflakes - lawandordersvu - dannypino - oliviabenson - sergeant - mariskahargitay - bensaro - svu - nickamaro -
eo_chriska - xxleonielovesparisxx - robinsonnomore1230 - peyton_f -
instagram
azumimidorikawa
Sergeant major Umbrella Corp & Colonel Phoenix S.T.A.R.S #AzuLing #cosplay #ResidentEvil #umbrellacorp #S.T.A.R.S #POLICE #sergeant #military #Army #honor #Colonel #japan #Mexico #Monterrey #cintermex #animex2014 #
residentevil - mexico - animex2014 - japan - police - monterrey - cosplay - army - umbrellacorp - colonel - azuling - s - sergeant - military - honor - cintermex -
marianne_wesker - tt00nnyy - official_ada_wong - perttukivilaakso -
instagram
differentkind_ofmeasurement
Sgt. John Munch 0231 Does anyone know the Captains badge number cause I can't find it anywhere??!! #0231 #sergeant #johnmunch #richardbelzer #svu #lawandordersvu #misshimsomuch #comebackmymunchkin
johnmunch - lawandordersvu - 0231 - misshimsomuch - comebackmymunchkin - sergeant - richardbelzer - svu -
mariskahargitayfansagainstrape - mariskahargitay_fan737 - mariska_swag - oliviahargitay_svu -
instagram
differentkind_ofmeasurement
Sgt. Olivia Benson 01139 Miss Sergeant 😊 #soproud #01139 #sergeant #oliviabenson #mariskahargitay #svu #lawandordersvu
01139 - sergeant - mariskahargitay - soproud - lawandordersvu - svu - oliviabenson -
hehohasmommy99 : That's awesome!
differentkind_ofmeasurement : @hehohasmommy99 thanks 😊
peyton_f - my_queen_mariska - arantzamurillosantin - love_benson_hargitay -
instagram
meghann_alyssa
#daughters #lovethem #father #daddy #soldier #sgt #sergeant #nationalguard #army #louisiana #cemetary #suicideprevention #sadbuthappy #babygirls
babygirls - army - cemetary - father - sgt - lovethem - soldier - sadbuthappy - suicideprevention - sergeant - nationalguard - daddy - louisiana - daughters -
__kaay_kaay - lay2282 - eshsena - kaylavirginia14 -
instagram
Iconosquare feedback