giekyivaldi
#PogonaVitticeps #BeardedDragon #dragonphotooftheday #reptileoninstagram #reptilelover #instacritter #dragobarbuto
instacritter - reptileoninstagram - beardeddragon - dragonphotooftheday - pogonavitticeps - dragobarbuto - reptilelover -
george_the_dragon - kirchhoff93 -
instagram
fluffyronja
The #mighty Ronja πŸ‘‘πŸŒΏπŸŒΎ The great #tacotonguetuesday is upon us! #ttt
weeklyfluff - petsconnect - we_love_cats - ttt - jj_forums - mighty - petscorner - instacritter - instapurrs - instacat_meows - tacotonguederpoff - nature_obsession_animals - cat2see - pets_perfection - petssubway - jj_welovepets - petviews - instabeautifulpets - catsofinstagram - swagpets - cats_of_instagram - igw_animals - jj_justcats - ic_animals - weeekly_feature - catscratchbieber - trb_creature_feature - tacotonguetuesday - igbest_animals -
fluffycatcharlie : Nom Nom Nom...
fenix_and_leija : Aaaw so beautiful!!! Great shot! πŸ˜»πŸ’—πŸ‘
dariareba : Sweetie
jk_olliecat : Yum !!
kycatbros : Ronja that tongue is amazing!!!!
fluffyronja : #igbest_animals
marygosh : βœ¨πŸ‘βœ¨πŸ‘βœ¨πŸ‘βœ¨πŸ‘βœ¨πŸ‘
fluffyronja : #trb_creature_feature
elainemarotta - harvard_cats - happydementor - haniekamil -
instagram
bugsnotdrugs
"So mum forgot that there was a waxworm in my tank and it turned into a moth...that moths life was short lived!" #tarantula #tarantulasofinstagram #arachnid #arachnidsofinstagram #animal #animalsoinstagram #spider #spidersofinstagram #pet #petstagram #petsofinstagram #instatarantula #instaspider #instaarachnid #instacritter #instaanimal #instapet #socute #firsttimeiveseenhereat #inneedofamolt #datgoldentrianglecarapacemark #couldnthurtafly #ohwaityeahitprobablywould
petstagram - couldnthurtafly - instaarachnid - instaanimal - socute - ohwaityeahitprobablywould - spider - instatarantula - spidersofinstagram - arachnid - instacritter - animalsoinstagram - instaspider - inneedofamolt - pet - petsofinstagram - tarantulasofinstagram - firsttimeiveseenhereat - datgoldentrianglecarapacemark - animal - instapet - tarantula - arachnidsofinstagram -
zcon24 : Wow gorgeous as always!!
naydoubleu2.0 : Lol I would have love to have seen that!
sniper10798 - rafi_mazi - emertallica - tarantulablog -
instagram
biancanovacaine
Look at how pretty Glu is all fired up😍😍 #glu #gecko #geckos #geckosofinstagram #halmahera #halmaheragecko #herper #moss #girlswithtattoos #instacritter #lizard #lizardsofinstagram #reptile #reptilesofinstagram #nofilter #picoftheday #petsofinstagram #love #coldblooded #beautiful
beautiful - reptile - love - instacritter - petsofinstagram - reptilesofinstagram - moss - halmahera - gecko - lizardsofinstagram - herper - geckosofinstagram - lizard - picoftheday - halmaheragecko - girlswithtattoos - coldblooded - nofilter - glu - geckos -
dee_muh - agonalfellatio - illusiongeckos - bayareadragonsden -
instagram
biancanovacaine
No this is not a leachie...this is my new halmahera gecko, he still has some growing to do and fattening up but god damn is he SO ADORABLE. So this is Glu and he's handsome and friendly #gecko #geckosofinstagram #picoftheday #moss #geckos #halmaheragecko #halmahera #beautiful #glu #reptile #reptilesofinstagram #nofilter #picoftheday #petsofinstagram #instacritter
beautiful - reptile - instacritter - geckosofinstagram - reptilesofinstagram - petsofinstagram - glu - halmaheragecko - moss - halmahera - nofilter - gecko - picoftheday - geckos -
thereptilepage - dailysnarfs - sarajewel193 - desireesworld -
instagram
mushumushi
Mushu held the silkworm in his mouth for a good 30 seconds before actually eating it! #beardeddragon #beardie #pogonavitticeps #silkworms #beardeddragonsofinstagram #beardiesofinstagram #instacritter #beautifulbeardie #beardienation #lizard #reptile #sandfire #mushuthebeardie
mushuthebeardie - reptile - beardeddragon - beardeddragonsofinstagram - pogonavitticeps - beardiesofinstagram - beautifulbeardie - silkworms - lizard - beardienation - instacritter - beardie - sandfire -
iggythebeardie : Iggy once held a roach under water for minutes... and never ate itπŸ˜’ hahaha
aliiiix - bomysrex - sinvegasroaches - jujutheking -
instagram
alisa0403
27 Grad. Viele gehen Baden. Viele sind im Urlaub. Alisa noch nicht. Projekt LektΓΌre von Picasso ;-) :-P #funny #perfekt #holliday #instagood #selfmade #instacritter #instacool #webstagram #lol #like4like #feelgood #happy #picasso #art
funny - webstagram - art - selfmade - lol - instagood - holliday - instacool - instacritter - perfekt - picasso - feelgood - like4like - happy -
hknc22 - furkan3101 - jake_jones_13 - narminsharifova -
instagram
alisa0403
Giesela mags bunt. #giesela #kitti #cat #funny #perfekt #photooftheday #instagood #selfmade #instacritter #instacool #webstagram #lol #like4like #ichsehedich
funny - webstagram - selfmade - ichsehedich - lol - cat - instacool - instacritter - instagood - perfekt - like4like - kitti - giesela - photooftheday -
diamondwhitley : Nice pic!
kendallkitties - teforning5897 - w0nder_v0id_ - martina71098 -
instagram
mickiwitcher
#instacritter #bffs #koleandloudog #newbies
newbies - bffs - instacritter - koleandloudog -
ultras1922 -
instagram
mickiwitcher
#sampson #myhomie #instacritter
myhomie - instacritter - sampson -
j_lynne78 - ultras1922 - mickibroome -
instagram
alisa0403
Wow was is das nasses was da vom Himmel fΓ€llt? #giesela #kitti #cat #window #rain #cute #funny #perfekt #photooftheday #instagood #selfmade #instacritter #instacool #webstagram #lol #like4like #feelgood #happy #ichsehedich
cute - ichsehedich - happy - rain - giesela - instacritter - perfekt - instagood - kitti - funny - like4like - selfmade - lol - cat - window - instacool - webstagram - feelgood - photooftheday -
bellybutton_fluffxd - johnstoyer - kth1712 - fenchen2001 -
instagram
bugsnotdrugs
"I also molted and got my adult colours! I'm also a confirmed female now!!" #tarantula #tarantulasofinstagram #arachnid #arachnidsofinstagram #spider #spidersofinstagram #animal #animalsoinstagram #pet #petstagram #petsofinstagram #instatarantula #instaspider #instaarachnid #instacritter #instaanimal #instapet #datcarapace #sofuzzy #stillmoodyasfuck #evenmorebeautifulnow #futurebreedingproject #literallyoncloudnine
petstagram - arachnidsofinstagram - instaarachnid - instaanimal - spider - instatarantula - spidersofinstagram - literallyoncloudnine - arachnid - instacritter - animalsoinstagram - instaspider - datcarapace - sofuzzy - pet - petsofinstagram - tarantulasofinstagram - evenmorebeautifulnow - futurebreedingproject - stillmoodyasfuck - animal - instapet - tarantula -
zcon24 : Gorgeous
bugsnotdrugs : @jboswell84 aw Jesus I've actually yet to have any of my lot destroy their moults, we always nab it before they get the chance haha!
bugsnotdrugs : @zcon24 thank you! :D
justiceforall89 : platyomma?
bugsnotdrugs : @justiceforall89 nigricolor :)
edward_the_bear : So pretty!
bugsnotdrugs : @edward_the_bear thank you! :)
evieandtom : Do you cuddle you Ts at night @bugsnotdrugs
amtarantulas - arisgalindo - gamboagainz - tarantulasophie___ -
instagram
alisonheap
The difference a year makes. #lizard#beardeddragon#rescue#rescuelizard#starving#fat#happy#happylizard#critter#instacritter#transformation#oneyear#neglect#loved#spoiled#terrarium#bearded#beardedlizard
starving - rescuelizard - rescue - bearded - fat - oneyear - happylizard - instacritter - loved - beardeddragon - terrarium - neglect - lizard - beardedlizard - spoiled - critter - transformation - happy -
davevmaxx : Looking healthy
italstallion11 : Can I eat this one? Lol
alisonheap : Stop trying to eat my pets!!! @italstallion11
flguardgio - alexandria4591 - zfreeze - zihak -
instagram
mushumushi
Out of sight, out of mind #nightnight πŸ™ˆ #goodnight #sleepy #dragon #beardeddragon #beardie #pogonavitticeps #sandfire #lizard #reptile #herp #beautifulbeardie #instacritter
reptile - beardeddragon - dragon - pogonavitticeps - sleepy - goodnight - beautifulbeardie - nightnight - lizard - instacritter - beardie - sandfire - herp -
dart_frogz - ppereptiles - megann_aguilar - joesdragonsnyc -
instagram
alisa0403
Dirk & Alisa #funny #perfekt #holliday #instagood #selfmade #instacritter #instacool #webstagram #lol #like4like #feelgood #happy #italy
funny - webstagram - italy - selfmade - lol - instagood - holliday - instacool - instacritter - perfekt - love - feelgood - like4like - happy -
alisa0403 : Nein das ist mein neffe.
alisa0403 : My #love
alisa0403 : Meine traurige liebe die ich mir mit seiner Frau teile und die Augen davor einfach verschließe
doc_gastronomia : πŸ‘
fargone1 - 6vinny9 - newvisionteam - hknc22 -
instagram
alisa0403
#free #funny #perfektday #instagood #selfmade #instacritter #instacool #webstagram #lol #like4like #feelgood #happy #garden #party
funny - webstagram - selfmade - perfektday - free - instagood - instacool - lol - instacritter - party - feelgood - garden - like4like - happy -
furkan3101 : πŸ‘
visionchaser - majsty_nawaf_alshammri - fahimsphotography2 - fahimsphotography -
instagram
pakdatbwl
Contrasted friends. #crossed #contrasted #crazycritters #crittertime #instacritter #thesedogstho
contrasted - crossed - instacritter - crazycritters - crittertime - thesedogstho -
grady0122 : Ebony & Ivory
pakdatbwl : @grady0122 Or dumb & dumber 🐾🐾
grady0122 : I can see that too ;)
henryjackie87 - buffalomitts - hailstormg - becks1929 -
instagram
mushumushi
I'm a big boy now. I can blackbeard whenever I want to!! #beardeddragon #beardie #random #black #beard #beautifulbeardies #dragonphotooftheday #beardiephotooftheday #beardienation #grownup #mushuthebeardie #instacritter #beardeddragonsofinstagram #beardiesofinstagram #cute #nofilter #selfie
cute - instacritter - beardeddragonsofinstagram - selfie - random - beautifulbeardies - beardienation - beardiephotooftheday - mushuthebeardie - beardeddragon - dragonphotooftheday - beardiesofinstagram - black - beardie - grownup - nofilter - beard -
reptiles11 - mccoy_diesel - focusthedog - wowpao -
instagram
bugsnotdrugs
"Look mum! I molted and got my adult colours!!" #tarantula #tarantulasofinstagram #arachnid #arachnidsofinstagram #spider #spidersofinstagram #animal #animalsoinstagram #pet #petstagram #petsofinstagram #instatarantula #instaspider #instaarachnid #instacritter #instaanimal #instapet #kickedhairsatmealready #sameoldisis #somanymoltsrecently #lovingit #confirmedfemalehellyeah
petstagram - arachnidsofinstagram - instaarachnid - instaanimal - instaspider - spider - instatarantula - spidersofinstagram - arachnid - instacritter - sameoldisis - animalsoinstagram - confirmedfemalehellyeah - kickedhairsatmealready - pet - petsofinstagram - somanymoltsrecently - animal - instapet - tarantula - lovingit - tarantulasofinstagram -
edward_the_bear : Such a proud moment!
bugsnotdrugs : @edward_the_bear really is :') we've had 4 molts and all of them have been female molts!!
evieandtom - the_jigsawkiller - camirose1 - emiliagnt -
instagram
blueeyeddevil0812
#chillin #relaxin #lizard #beardeddragon #rex #critter #instacritter #lizardlife #yellowandorange #cool #imaboutthatlife
rex - relaxin - beardeddragon - lizardlife - yellowandorange - lizard - instacritter - critter - imaboutthatlife - chillin - cool -
bennsmellissa - bdragonlover - laurenloveslashes - meinemma -
instagram
bugsnotdrugs
"Look mum I ate for the first time!" (I feel like a proud mum :')) #tarantula #tarantulasofinstagram #arachnid #arachnidsofinstagram #spider #spidersofinstagram #animal #animalsoinstagram #pet #petstagram #petsofinstagram #instatarantula #instaspider #instaarachnid #instacritter #instaanimal #instapet #sofuckingsmall #socute #attagirl #proudmother #lookslikeshegothershittogether #slingmoralityratescankissmyass
petstagram - arachnidsofinstagram - instaarachnid - instaanimal - socute - lookslikeshegothershittogether - spider - instatarantula - spidersofinstagram - arachnid - instacritter - animalsoinstagram - proudmother - instaspider - pet - slingmoralityratescankissmyass - petsofinstagram - tarantulasofinstagram - attagirl - animal - instapet - tarantula - sofuckingsmall -
edward_the_bear : Did you tear up?
bugsnotdrugs : @edward_the_bear we did aye, took it down before we even let go of the tongs
boards_addict : Sling verscolor ?
bugsnotdrugs : @boards_addict yep! :D
shortandsweet76 - bellarachnid - taheer18 - elaborateneurotic -
instagram
mushumushi
My favorite game- catch me if you can!!!! #beardeddragon #inmotion #pogonavitticeps #beardie #beardienation #beautifulbeardies #beardielove #instacritter #reptile #lizard #cute #running #beardeddragonsofinstagram #beardiesofinstagram #dragon #dragonsofinstagram
cute - reptile - beardeddragonsofinstagram - running - beardienation - instacritter - beardielove - inmotion - beardeddragon - pogonavitticeps - beardiesofinstagram - dragon - lizard - beardie - dragonsofinstagram - beautifulbeardies -
suefa70 - poisedfangs - oscar_thedragon - jujutheking -
instagram
bugsnotdrugs
Good times ahead for ole McDowell here! First of all I won a competition for Β£20 towards a tarantula dealer of any choice (I chose thespidershop) with that I bought 5 P. regalis slings which I will be raising as a commune!! Also we had a molt from my P. nigricolor and it's a female! ALSO my good friend Lee Beck is sending me a few free slings as a kind gesture over something bad that happened to me a while so I have that to look forward to as well! Good times people! :D #tarantula #tarantulasofinstagram #arachnid #arachnidsofinstagram #spider #spidersofinstagram #animal #animalsoinstagram #pet #petstagram #petsofinstagram #instatarantula #instaspider #instaarachnid #instacritter #instaanimal #instapet #overthemoon #slingsslingseverywhere #freeshithellyeah #sograteful #sothankful #lifeisgood
petstagram - arachnidsofinstagram - instaarachnid - instaanimal - overthemoon - sothankful - slingsslingseverywhere - spider - instatarantula - spidersofinstagram - arachnid - instacritter - animalsoinstagram - instaspider - sograteful - freeshithellyeah - pet - petsofinstagram - tarantulasofinstagram - animal - instapet - tarantula - lifeisgood -
jimothy70 : I knew what your word meant i was just teasing you about it ,:) @naydoubleu2.0
naydoubleu2.0 : Biggest jerk I know :P @jimothy70
jimothy70 : Thanks pick on the big guy @naydoubleu2.0 isee :)
olivegrenade : wow, whoever gave you that money must be pretty awesome ;)
bugsnotdrugs : @olivegrenade she is indeed! ;)
olivegrenade : Are you getting the poeci communal? Or did you already and I somehow missed the pics?
bugsnotdrugs : @olivegrenade getting the communal haven't heard anything from Lee yet
olivegrenade : What a dick :P
olivegrenade - jboswell84 - tillystarantulas - withrutile -
instagram
mugen_fan
Look into my eyes. #sunbathing #lizard #beardeddragon #beardie #aussie #summer #coldbloodedlove #instacritter #instalizard #thosecolorsdoe #organiconlydiet
summer - sunbathing - coldbloodedlove - instalizard - organiconlydiet - lizard - instacritter - beardie - aussie - thosecolorsdoe - beardeddragon -
bonesawse - viljapeppi - kevinnn85 - mfs_indesign -
instagram
mugen_fan
Rango hanging out. #rango #beardie #dragon #beardeddragon #lizard #instacritter #instapet #coldbloodedlove #reptile #godzilla #gozirra
reptile - beardeddragon - godzilla - coldbloodedlove - dragon - instapet - lizard - instacritter - beardie - rango - gozirra -
cwk_reptiles - 4b11josh - vanillla_mint - kevinnn85 -
instagram
bugsnotdrugs
"Mum had to take me out of my enclosure to redecorate, my enclosure looks great now!" #tarantula #tarantulasofinstagram #arachnid #arachnidsofinstagram #spider #spidersofinstagram #animal #animalsoinstagram #pet #petstagram #petsofinstagram #instatarantula #instaspider #instaarachnid #instacritter #instaanimal #instapet #suchasweetie #nervedamageddarling #notabadthingtosayabouther #myfavouritebrachy #soclumsy #shelllookfabwhenshesolder
petstagram - arachnidsofinstagram - instaarachnid - soclumsy - instaanimal - nervedamageddarling - spider - instatarantula - spidersofinstagram - myfavouritebrachy - arachnid - instacritter - animalsoinstagram - suchasweetie - instaspider - pet - petsofinstagram - tarantulasofinstagram - animal - instapet - tarantula - shelllookfabwhenshesolder - notabadthingtosayabouther -
zcon24 : Gorgeous!! Is this B. klassi? @bugsnotdrugs
bugsnotdrugs : @zcon24 it is indeed! :D
zcon24 : Well I'm truly jealous haha they are so expensive here in the US. Is this one female? @bugsnotdrugs
bugsnotdrugs : @zcon24 I'm not sure yet it hasn't molted! Oh I've heard :( it's kind of sad that she was free then!
zcon24 : This one was free? That's crazy @bugsnotdrugs
bugsnotdrugs : @zcon24 yeah because she has a bit of nerve damage (you can't even tell) so Lee from thespidershop gave them to people if they made an order with them :)
zcon24 : That's really cool and when you say nerve damage what does that mean is she jumpy or something?
zcon24 : @bugsnotdrugs
shortandsweet76 - kimberlycastaneda1214 - taheer18 - zcon24 -
instagram
shaneamos90
Who says lizards don't cuddle? #beardie #beardeddragon #cuddle #instapet #instacritter #reptile #lizard #family
reptile - beardeddragon - family - lizard - cuddle - instacritter - beardie - instapet -
mr__diabetic : @balauren
crazyreptilelovers - jfdezfgres - 666mell - pogonanightmaredragons -
instagram
mushumushi
Enjoying the sunset on my new favorite spot! πŸŒ„ #windowsill #beardeddragon #beardie #pogonavitticeps #beardeddragonsofinstagram #beardiesofinstagram #reptile #lizard #instacritter #herp
reptile - beardeddragon - windowsill - beardeddragonsofinstagram - pogonavitticeps - beardiesofinstagram - lizard - instacritter - beardie - herp -
renn5224 - scienceg33k - samol97 - dubiatheroach -
instagram
bugsnotdrugs
"This is MY water dish, and I will put as much substrate in it as I want!!" #tarantula #tarantulasofinstagram #arachnid #arachnidsofinstagram #spider #spidersofinstagram #animal #animalsoinstagram #pet #petstagram #petsofinstagram #instatarantula #instaspider #instaarachnid #instacritter #instaanimal #instapet #damnnahndus #howamisupposedtogiveyouwater #waterudoin #shescalledisis #awkward #hopeshemoltssoon #ifitsagirlillcry
petstagram - arachnidsofinstagram - howamisupposedtogiveyouwater - instaarachnid - instaanimal - spider - instatarantula - spidersofinstagram - arachnid - instacritter - waterudoin - animalsoinstagram - hopeshemoltssoon - instaspider - damnnahndus - awkward - pet - petsofinstagram - tarantulasofinstagram - shescalledisis - animal - ifitsagirlillcry - instapet - tarantula -
bugsnotdrugs : @ameliageee damn chromatus's haha!
riverajohndavidyahoocom : Lol never fails
edward_the_bear : My G.Pulchripes always does the same!
zeezums : My chromatus does the same πŸ˜‚ she even ripped the hygrometer off the wall and buried it after she laid an eggsac n
bugsnotdrugs : @edward_the_bear as does mine! It's a pain in my ass!
bugsnotdrugs : @zeezums flip me! What a strange tarantula!
ablaurock99 : My X. Intermedia did that. I had even substrate and it became an extremely steep hill with the dirt nearly hitting the cage top πŸ˜‚πŸ˜‚
bugsnotdrugs : @ablaurock99 haha! Tarantulas are really strange little creatures
annarooski - avifanatic - gamboagainz - scienceg33k -
instagram
justanotherawesomeblogg
Won't be loosing any toes todayπŸ’ #InstaSize #instacritter #gecko #leopard #leopardgecko #hes #soaking #so #his #toes #wont #fall #off #im #not #crazy #shed #stuck #in #them #sorrynotsorry #he #still #loves #me #and #i #love #him
and - me - crazy - his - love - leopardgecko - fall - leopard - shed - toes - im - instacritter - in - not - still - gecko - him - he - wont - them - off - hes - i - soaking - instasize - stuck - sorrynotsorry - loves - so -
willid123 : I want him πŸŠπŸ‘Œ @justanotherawesomeblogg
justanotherawesomeblogg : I know you do bestie I knowπŸ˜‚ we can share him! @willid123
_mig_paa_hesteryg_ - kristin_jackson02 - imperial.afflictions - heyitskayleeeeee -
instagram
bugsnotdrugs
"To or to not take the waxworm, that is the million dollar question" (she didn't take the waxworm, she decided to kick hairs at me and run away) #tarantula #tarantulasofinstagram #arachnid #arachnidsofinstagram #spider #spidersofinstagram #animal #animalsoinstagram #pet #petstagram #petsofinstagram #instatarantula #instaspider #instaarachnid #instacritter #instaanimal #instapet #whitekneedlittleshit #thatbaldbumtho #sokicky #youcouldtellstraightawayifshewasinpremolt #sheusedtobenice #whathappened
petstagram - arachnidsofinstagram - instaarachnid - instaanimal - whitekneedlittleshit - spider - instatarantula - spidersofinstagram - arachnid - instacritter - animalsoinstagram - youcouldtellstraightawayifshewasinpremolt - instaspider - sokicky - thatbaldbumtho - pet - petsofinstagram - tarantulasofinstagram - sheusedtobenice - whathappened - animal - instapet - tarantula -
evieandtom : Macbeth
some_basic_smut : Basically every a. Geniculata right there πŸ˜‚
ablaurock99 - xakom - mccotton - tillystarantulas -
instagram
luxe_absolu
My new friend I made in recent travels! #parrot #ocean #beach #macaw #sc #gorgeous #mylife #bosslife #wealthy #affluent #travel #instacritter
macaw - instacritter - parrot - bosslife - travel - wealthy - mine - ocean - dontdoit - mylife - gorgeous - sc - scam - ripoff - affluent - beach - reportinappropriate -
john_henry_money : Text Me For Info On How To Make Some Quick Cash With Vanilla Reload. 1209 794 4508
luxe_absolu : This is a scam, they have you load the money on a vanilla reload card then request the code on the back, once you give it to them they will load your money onto their personal prepaid card, block you from the instagram account, and dissapear with your hard earned money. Please beware. @john_henry_money #scam #reportinappropriate #ripoff #dontdoit ☝☝☝☝☝☝☝☝☝
luxe_absolu : #mine
miss1candy - dustinandtracy - forexapps - loganmanning59 -
instagram
mushumushi
I love my supers! πŸ› #superworms #snacktime #yummy #beardeddragon #beardie #pogonavitticeps #beautifulbeardies #dragonphotooftheday #beardiesofinstagram #beardeddragonsofinstagram #reptile #lizard #dragon #instacritter #beardienation #beardielove
reptile - beardeddragonsofinstagram - beardienation - instacritter - beardielove - yummy - beardeddragon - dragonphotooftheday - pogonavitticeps - beardiesofinstagram - dragon - lizard - superworms - beardie - snacktime - beautifulbeardies -
_peyton_garner_ : Were did you get the leash from
haleychristina : @_peyton_garner_ They have great ones on etsy! :) I got @petefluff from there.
brooklyn_stringer13 - caimans_zoo - beardiee - bettathanyou101 -
instagram
Iconosquare feedback