animal_ambition__
Completed every objective I set out for today and this was the cherry on top #FatKidShit #iLoveCheescake #GoodTimes #GoodFriends
ilovecheescake - goodfriends - goodtimes - fatkidshit -
italiasia : Happy birthday!! 🎂 🎁 🎉 @animal_ambition__
o6venomz : Happy birthday bro
ooof_money : Happy birthday enjoy @animal_ambition__
deonneee : Happy belated birthday ☺
animal_ambition__ : Thanks @deonneee @o6venomz hope everything is great with ya'll and Noah!
animal_ambition__ : Thanks bro @__reall_nastyy you know that Henny white was on deck lol
animal_ambition__ : Thanks @italiasia @hayjade @ooof_money @am0s88 @stellaroze333 @cityofsin_ @_kevoo7 @shanicestreet @sst962 @jenthefitfoodie
geniebear : Bro! So sorry that I'm late but happy belated! I've been crazy with school. I love you
bullroasted - aces_wilde - __reall_nastyy - _kiddphila -
instagram
kizzo77
You know I got to.#Bbq #fatKidShit
bbq - fatkidshit -
da_butcher92 - mattich13 - austin1311 - geleteij -
instagram
candy_mcswole
Because bacon! #thatswhy Cheat day nom noms. 😆 🐖🐷🐖🐷🐖🐷🐖🐷🐖🐷 #oinkoink #fatkidshit #merica
thatswhy - merica - oinkoink - fatkidshit -
samwanderley : 😍😍😍😍
samwanderley : Linda demais
samwanderley : 💕
roshoooo : @obb_3t 😍😍😍😍
acevedodario10 - gothamcity2234 - brynn_faye - lionheart_supplements -
instagram
daniellelespasio
Nothing better than cool blue Gatorade, buff chic dip and Netflix when yah feel like shit #fatkidshit #hangovercure
hangovercure - fatkidshit -
nlespasio : Why are we the same
paiigehughes - caputooo - hlemay3 - nlespasio -
instagram
nicobeenon
#fatkidshit #foodporn
foodporn - fatkidshit -
jill_ - d_dawg561 - eccentric_85 - spade2trill -
instagram
eltrife
They done hooked a ninja up with the good shit #nomnomnom #fatkidshit
nomnomnom - fatkidshit -
__mrszb__ - youlike_whatusee - mikesean06 - davedigi1970 -
instagram
kashmode
At the J.O. B!!! 2 pb cookies with pb& j in between them. #heartattack #fatkidshit #Elviscookies
elviscookies - heartattack - fatkidshit -
allid214 - lifesaverliz - duhhitslexsha - morgans_smile -
instagram
groady_wang
Protein style >
foodgasm - foodporn - food - foodphotography - goodeats - fatkidshit - fatkidmafia - foodie - fuego - bombdotcom - fkm - fakefoodie - fatkidproblems - noms - fatkidstruggles - vscocam -
groady_wang : #vscocam #foodphotography #foodporn #food #foodie #foodgasm #GoodEats #bombdotcom #fuego #noms #FatKidStruggles #fatkidshit #fatkidproblems #FatKidMafia #fkm #fakefoodie
thanislim : Food is love!
626foodie : 😍
baffledaz : Marvelous post
gohawkscyd12 - thatsohabs - melis.in.wanderland - mr_justwin -
instagram
doc_rockz1
#SundayFunday #SundayDinner #tenderloin #macncheese #greenbeans #cabbage #FatKidShit #Food #Mood
macncheese - mood - food - sundayfunday - greenbeans - tenderloin - fatkidshit - sundaydinner - cabbage -
thecheesious - dabadgalcici - hailzyes - spicysourfaceheadass -
instagram
groady_wang
Diablo...
foodgasm - fkm - goodeats - fatkidshit - noms - fatkidmafia - fatkidstruggles - snackporn - bombdotcom -
groady_wang : #SnackPorn #foodgasm #GoodEats #bombdotcom #FatKidStruggles #fatkidshit #fkm #FatKidMafia #noms
hwc_papeshfoo - johndoe216_ - _migz305 - mr_justwin -
instagram
doc_rockz1
#SundayFunday #SundayDinner #Prep #roastedtenderloin #cabbage #macncheese #staytuned #FatKidShit #Food #Mood #hungry
macncheese - roastedtenderloin - food - sundayfunday - hungry - fatkidshit - staytuned - sundaydinner - cabbage - prep - mood -
luvrose29 - mzjacksonifu - epitome_ofa_scorpio - beetrootbetty -
instagram
nicobeenon
#excell #fatkidshit #griot
griot - excell - fatkidshit -
milsotweet - therealbonnie - jazzyjaz305 - v2cute24 -
instagram
melis10180108
Reveling in the deliciousness that is Kohrs. And still in disbelief that @nfjbastard has never tried it. So good. 🍦❤️🍦 #maytd #bestfriendshit #fatkidshit #kohrs #hemakesmehappywhenskiesaregrey
hemakesmehappywhenskiesaregrey - bestfriendshit - kohrs - maytd - fatkidshit -
kerrybeemilnes : Never??? It's the best!!
melis10180108 : @kerrybeemilnes I know!!!
kj_franzson : There is on in Fairfield
kellyvazzz : Where did you get this 😫
melis10180108 : @kfranzson that's the one I was at. So awesome. @kellyvazzz Fairfield.! We must go sister
loligirl7 : Melis, I love the one in Fairfield and they have all kinds of swirls to give the custard diff flavored. I live 10 min away. I'd love to see u and ur beautiful boys. Just message me on FB if ur around. Love u my babygirl ❤️
melis10180108 : @loligirl7 oh I didn't know you were so close! I would love to come see you. I'll message you we can set something up 💕 love u too so much 😊
bjw_1990 - joecap78 - gina020 - jillyfalk -
instagram
suga_bps
@thereal_richiebankss 😛😛😛😛 #fatkidshit #TEAMPÜRESUGÃR #ALLHAILTHEQUEEN #QUEENINSOMNIAAPPROVED #QUEENASAPATLAPPROVED #QUEENFRESHSTATIONAPPROVED #QUEENPÜRESUGÃRAPPROVEDMESSAGE 💋 ✌
teampüresugãr - allhailthequeen - queenfreshstationapproved - queenpüresugãrapprovedmessage - queenasapatlapproved - queeninsomniaapproved - fatkidshit -
instagram
niamoone
Fcuk this workout shit! I just wanna b fat at this point!! 🐷🐋🐄🐳 #fatkidshit
fatkidshit -
kerawblacksheep : Nooooo we can't I be feeling U boo tho..
amilleyon_mora : 🎎
ab_ent : 😂😂😂
he_something_special - royfuro - mr_all_out - _same_o_gee -
instagram
xmunky
I don't drink or get high or any of that shit but I got a serious addiction to mexican food.. brisket nachos 🐖 #fatkidshit
fatkidshit -
scott_bayvaria : Move to California. The Mexican food is 🔥
xmunky : I'd end up being 400 lbs haha : ) @scott_bayvaria
elham_mojadedi - vanv39 - tesko_pk - aco_e28 -
instagram
macgillakuddy
Don't bother me, I'm eating #HardKnoxCafe #SpicyChicken #MacNCheese #CornBread #SoulFood #SanFrancisco #California #FoodPorn #FatKidShit #ShmackCity
sanfrancisco - foodporn - macncheese - fatkidshit - shmackcity - spicychicken - california - soulfood - cornbread - hardknoxcafe -
frannyfullpint : 😍🍗
w02420 - dan.yelo - flawlyssssssss - betorozay -
instagram
vicious_of_iscariot
Authentic Mexican tacos... Oh I'm about to go in #FatkidShit #ElVicE
elvice - fatkidshit -
badazzquana - fatherless_80s - her_charlie_ - portiake -
instagram
nicobeenon
#fatkidshit
fatkidshit -
shasha5618 : You cray
brooklynxbred - jill_ - meetthegilliards - awarner0312 -
instagram
dappergent87
When your TRYING to keep this #HealthyLifestyle up BUT the #Devil😈 KNOWS your WEAK smh😒❗️❗️ S/N: The #Devil ain't win THIS ONE,I opted for #TrailMix🙌🏾.... #Kik #DailyStruggles #FatBoyProblems #FatKidShit #FoodMakesMeHappy😌
devil - fatboyproblems - fatkidshit - kik - foodmakesmehappy😌 - dailystruggles - thighs - healthylifestyle - buttock - devil😈 - trailmix🙌🏾 -
muzikizmynature : Don't do it Miss Celie.....don't do it!
dappergent87 : 😂😂 @muzikizmynature
cvanderpump : Go ahead and get a snicker ice cream 😈
dappergent87 : My #Thighs & #Buttock says🚫😩 @cvanderpump
doinitwaybig29 : #BeardonFleek #yyyyyyyyyyeeeeeeeessssssssssss
dappergent87 : 🙌🏾 @doinitwaybig29
eggheaddev : Delicious
raulitopa - iamkaivyn - love.mesha - __killbill__ -
instagram
lizevora
Our movie snacks. #FatKidShit #Lays #DoUsAFlavor
dousaflavor - lays - fatkidshit -
aesthetically_nicole : Were any good?
lizevora : @aesthetically_nicole no. Not really. Disappointing.
lizevora : @aesthetically_nicole the truffle fries tasted like a lite version of sour cream and onion. The gyro tasted like cucumber and meat... Super gross. The Reuben tasted exactly like a Reuben sandwich. But nothing was amazing.
kcasey343 - mrs.boston - _livelaughlove86_ - iamluxurie -
instagram
dappergent87
🙈 I know I know I know❗️❗️ I'm soooooooo ASHAMED.... But #MarbleSlab was Eveeeeeryyyyyyything🙌🏾❤️ #FatKidShit #FatBoyProblems #HoustonNights😉
houstonnights😉 - fatboyproblems - marbleslab - fatkidshit -
ayeasha_graham : @imher_terab 😒
imher_terab : Hell now @dappergent87 @ayeasha_graham 😒
shanetgv : 👅
jeromefosterschild : #FitFayBoy 😊
dappergent87 : 👌🏾 @jeromefosterschild
tevin_kyree : Was it good?
dappergent87 : 🙌🏾 @tevin_kyree
tevin_kyree : @dappergent87 lls 😅 we all have our moments
roy_clarkson - spanishgypsy10 - _091708 - travis_106 -
instagram
nicobeenon
#fatkidshit #foodporn #ma plates
foodporn - ma - fatkidshit -
jill_ - jazzyjaz305 - nicobeenon - mag_nifi_cent -
instagram
bigizzysworld
So this is happening right now #krispykremeburger #fairfood #OCFair #fatkidshit #food #foodporn #dietbuster
dietbuster - ocfair - foodporn - food - krispykremeburger - fairfood - fatkidshit -
che_noa : Omg!😳
char_lay13 : 😧 my mind says no, but my fat says yes.
crystalo0524 : Omg I need that in my life!!!!
nique_honey : Not gonna lie that looks really good
bigizzysworld : Its okay....theres nothing on it just burger and donut lol @nique_honey
stirandstyle - kingsanja - jasmineldh__ - char_lay13 -
instagram
nicobeenon
#fatkidshit #concentrated my friend say this a sketch not black n white lol
concentrated - fatkidshit -
meetthegilliards : 💯
nicobeenon : @meetthegilliards 💯
benibx - jill_ - carolinasweetness - _pahkaah -
instagram
nicobeenon
#foodporn #fatkidshit #capitalgrille
fatkidshit - capitalgrille - foodporn -
officialfoodgroup : Gotta love the Cap! There mood lighting there always makes a picture tough to do it justice!
____peoples_____ : Eating good living better
nicobeenon : Already I'm Tryna eat like this for the rest of my life @____peoples_____
____peoples_____ : 💯💯💯
____peoples_____ - cjrodriguez3 - eccentric_85 - coolie09 -
instagram
kick_queen
Oh this happened at the #ohiostatefair as well #donutburger #goodeats #fatkidshit 🍩🍔☺️😋
donutburger - fatkidshit - goodeats - ohiostatefair -
kick_queen : @diezel_da_boss 😂
just_krozay : 👀
too_hot_2_deadstock : Noooo efffiinn waayyyyyyy 😢😢😢
kick_queen : @too_hot_2_deadstock 😏 yes bro.
checkmyretros : Why u aint make it a lutherburger
kick_queen : @checkmyretros because I didn't want to die 😆😆
checkmyretros : U wont die u just will touch heaven a lil bit 😂😂😂
kick_queen : @checkmyretros 💀😂
fortheloveofsoles - spudg1 - jassybelle24 - lovinthefood -
instagram
jay_wax
When in Rome #sonics #thisishowyousonic #sgeb #smokegoodeatbetter #foodporn #foodflex #fatkidshit #fatboyproductiins #coneydog #route44cherrylimeade #420 #wfayo #bitxhimhigh #high_larry_us #pushtrees
foodflex - thisishowyousonic - foodporn - bitxhimhigh - wfayo - coneydog - route44cherrylimeade - pushtrees - fatkidshit - fatboyproductiins - high_larry_us - smokegoodeatbetter - 420 - sonics - sgeb -
feedingmylungs : Yummy
hwcdeliveryoc - chronicstheshit805_209 - whimsickalcreations - youngcultivata -
instagram
oaklandblonde
Cheeeeeeese 😍 #fondue #fatkidshit #cheese #themeltingpot #datenight #foodporn #oaklandblonde
cheese - fondue - themeltingpot - foodporn - datenight - oaklandblonde - fatkidshit -
dezerts : nice shot check out our page!
mysecretlookbook - mikaharmony - lucyinabow - fancycorrectitude -
instagram
joyzeee3
Couldn't wait! Had to get a quick taste before pulling off. #fatkidshit #twoslices #cheesecakefactory #cheesecake #whitechocolatemacadamianut #carrotcake
carrotcake - whitechocolatemacadamianut - cheesecake - cheesecakefactory - twoslices - fatkidshit -
allisonkathleeen - melstervelarde - lovosoul - lnpetermann -
instagram
1.800_b_petty
A day late but.... Made myself some Bday cupcakes 😁♌️🎂
fatkidshit -
1.800_b_petty : U want me to send it n the mail 😒 @hotnyrican327???
hotnyrican327 : 😂😂😂😂Yea!!!!! Juncos PR @1.800_b_petty
illprep : @1.800_b_petty oh shit can I get some
1.800_b_petty : Ok @hotnyrican327 look for it in the mail... Should b there by next Thursday 😂😂
bighomie_box : I remember I used to love to lick the bowl
1.800_b_petty : #FatKidShit 😩😩 @bighomie_box I did the same thing!
elle.elle__ : I want in.
_keyser__soze : Save me a piece of one 🙏
msddliterally - _mr_adidas - hotnyrican327 - dulce_boricua_foreva -
instagram
minh_nguyen215
#mytypeofparty 😝 #itsgoingdown #raumuongluoc #thitbaroi #canhraumuong #whyilive #peopleeattoliveilivetoeat #istayhungry #foodisbae #momthrowsdown #fatkidshit #illalwaysbeherfatkid
illalwaysbeherfatkid - mytypeofparty - raumuongluoc - istayhungry - momthrowsdown - fatkidshit - whyilive - thitbaroi - canhraumuong - peopleeattoliveilivetoeat - itsgoingdown - foodisbae -
kattszi : I actually made this two days ago too LOL
hippo_yujin - tammyhuynhs - ___chemiie - bbong_bg -
instagram
ism0kel0ud
That bring me back #foodporn #foodflex #nachos #fatkidshit #smokegoodeatbetter #SGEB
foodflex - smokegoodeatbetter - foodporn - nachos - sgeb - fatkidshit -
jay_wax : Player plugged on the sour cream
scissor_chavez : 1st glance thought it was them steak fries from momos
rachelstayshigh : That crema
realsmoovelike : Where at?
tallkush : Looks 🔥
hayleyshania : @dgsc
squidbilly : Wats ur contact bra @ism0kel0ud
ism0kel0ud : 7076419522 @squidbilly
mustlovenachos - hits_of_haze420 - skr4pn.benz.wr - gmfbsd -
instagram
Iconosquare feedback