By accessing this website, you acknowledge and accept the use of cookies. Learn More

princessyahrini

Syahrini

384 21601
#work #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #sctvmusicawards2016 #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1228 58297
1140 37266
#work #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #throwback #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata #paris_maret2016
1013 50181
775 34815
#hairdo #imakeyoulookfabulous #carendeano #personalstylist #fashionstyling #princessyahrini #fashionstylist #indonesiancelebrity #headpiece #repost
649 38447
#work #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglainp #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjaindonesia #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1244 47483
3346 40049
1286 46446
2614 55186
#work #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1273 54803
#work #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1126 53547
#work #wanitamanjatidakbanyakbicaratapinyata #solo_24april2016 #wanitamanjaantijetlag #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #princessyahrini #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1608 70806
1638 54215
#work #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #solo_23april #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjaindonesia #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglainj #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1094 54623
#work #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #solo_23april2016 #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1316 53916
#friendforlife #wanitamanjatidakbanyakbicaratapinyata #bff #wanitamanjamasakini #wanitamanjaharusseringpiknik #work #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaantijetlag #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #princessyahrini #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1093 49382
1142 37192
1029 42411
#work #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjamasakiniharuskuat #wanitamanjaharuskerjakeras #wanitamanjamasakiniharushebat #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
2066 65911
1035 40849
#work #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjamasakini #wanitamanjaharusseringpiknik #streetstyle #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #streetfashion #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1108 57666
#work #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1376 60350
1346 43928
#singapore_19april2016 #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #work #sisterhood #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1343 66233
#singapore_18april2016 #work #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
2459 82258
1210 44960
#friendforlife #wanitamanjatidakbanyakbicaratapinyata #princessyahrini #wanitamanjaantijetlag #wanitamanjamasakini #wanitamanjaharusseringpiknik #work #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #wanitamanjaharusbahagia #wanitamanjaharusberkarya #onduty #wanitamanjaharuskreatif #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1183 52143
#wanitamanjatidakbanyakbicaratapinyata #wanitamanjaharusbahagia #wanitamanjamasakini #wanitamanjaharusseringpiknik #work #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #jakarta_17april2016 #wanitamanjaharuskerjakeras #princessyahrini #wanitamanjaharusberkarya #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
1125 56140
928 42267
#wanitamanjatidakbanyakbicaratapinyata #wanitamanjaharusbahagia #wanitamanjamasakini #wanitamanjaharusseringpiknik #work #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #princessyahrini #wanitamanjaharusberkarya #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata #surabaya_16april2016
1230 54620
#work #wanitamanjatidakbanyakbicaratapinyata #wanitamanjaantijetlag #wanitamanjaharusseringpiknik #wanitamanjamasakini #wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain #wanitamanjaindonesia #wanitamanjaharuskerjakeras #princessyahrini #wanitamanjaharusberkarya #onduty #wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata
973 46216
992 42052
princessyahrini - Syahrini
My Song "Kau Tak Punya Hati" πŸ‘‰On iTunes !!! About Last Nite Beautiful Dress From @susan_zhuang Thank You Sayang πŸ’ β€ͺ #PrincesSyahrini #Work #Onduty #WanitaManjaMasaKini #WanitaManjaIndonesia #WanitaManjaHarusKerjaKeras #WanitaManjaAntiJetlag #WanitaManjaHarusBahagia #WanitaManjaHarusSeringPiknik #WanitaManjaHarusBerkarya #WanitaManjaTidakBanyakBicaraTapiNyata #WanitaManjaTidakBolehLeyehLeyehManjaTapiPunyaCitraNyata #WanitaManjaTiadaAdaWaktuMikirinYangTakAdaFaedahApalagiMikirinOrangLain
work - wanitamanjatidakbanyakbicaratapinyata - princessyahrini - wanitamanjaantijetlag - wanitamanjaharusseringpiknik - wanitamanjamasakini - wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain - wanitamanjaindonesia - wanitamanjaharuskerjakeras - wanitamanjaharusbahagia - wanitamanjaharusberkarya - onduty - wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata -
angelica_adia_88 : Geregetan abisnya @gotze2827 sm org udah nuduh lip sync tp salah kayak si mbok ini @niar.ni πŸ™„πŸ™„ sotoy bgt ngata2in org pdhl dia yg salah ampun deh siriknya nyata bgt
vedinahmry : Cekii cekii @cokkermask_id yuks😍😍
hanaamons : 😍😍😍
poppysarah64 : πŸ‡΅πŸ‡¦πŸ‡ΎπŸ‡ΊπŸ‡©πŸ‡¦πŸ‡·πŸ‡¦ πŸ‡°πŸ‡ͺπŸ‡³πŸ‡¨πŸ‡¦πŸ‡³πŸ‡¬ HANYA 2 MINGGU, GAK TAKUT SUNTIK SILIKON !!! BAHAYA LOH !!! MENDING CARI AMAN AJA DI PAKARNYA, TANPA EFEKSAMPING @DRS.ADI.HERBALDUNIA.ID pin - 598B4424.
harni_izhar_ibrahim - cantykaameliacantyka - umi_tasya - janiceamandaa -
instagram
princessyahrini - Syahrini
Fierce look #SCTVMusicAwards2016 Makeup by @anpasuha Personal Stylist @carendelano Headpiece by @rinaldyayunardi Hairdo by @hairstylist_arrusa #PrincesSyahrini #Work #Onduty #WanitaManjaMasaKini #WanitaManjaIndonesia #WanitaManjaHarusKerjaKeras #WanitaManjaAntiJetlag #WanitaManjaHarusBahagia #WanitaManjaHarusSeringPiknik #WanitaManjaHarusBerkarya #WanitaManjaTidakBanyakBicaraTapiNyata #WanitaManjaTidakBolehLeyehLeyehManjaTapiPunyaCitraNyata #WanitaManjaTiadaAdaWaktuMikirinYangTakAdaFaedahApalagiMikirinOrangLain
work - wanitamanjatidakbanyakbicaratapinyata - princessyahrini - wanitamanjaantijetlag - wanitamanjaharusseringpiknik - wanitamanjamasakini - wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain - wanitamanjaindonesia - sctvmusicawards2016 - wanitamanjaharuskerjakeras - wanitamanjaharusbahagia - wanitamanjaharusberkarya - onduty - wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata -
royaljasmine148 : BESAR ATAU KECIL ITU PILIHAN TAPI KALAU BISA BESAR KENAPA HARUS MILIH KECIL? TEMUKAN RAHASIA PAYUDARA IDEALMU HANYA DI @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
nykkesatriaji : Princess syahrini kok bisa tambah cantik aja sih
youmooi : Cantiiik cantiiik...Mampir yuk DISKON MAKE UP LHO
poppysarah64 : πŸ‡΅πŸ‡¦πŸ‡ΎπŸ‡ΊπŸ‡©πŸ‡¦πŸ‡·πŸ‡¦ πŸ‡°πŸ‡ͺπŸ‡³πŸ‡¨πŸ‡¦πŸ‡³πŸ‡¬ HANYA 2 MINGGU, GAK TAKUT SUNTIK SILIKON !!! BAHAYA LOH !!! MENDING CARI AMAN AJA DI PAKARNYA, TANPA EFEKSAMPING @DRS.ADI.HERBALDUNIA.ID pin - 598B4424.
yhulishafithree - alfarizel_tuch - farisha_salsabila_h - ririn_astriyani -
instagram
princessyahrini - Syahrini
Sesaat lagi Aku dan @cakra.khan Akan berkolaborasi manja di panggung #SCTVMusicAwards2016 LIVE NOW! stay tune Pemirsaaahh !!! #PrincesSyahrini #Work #Onduty #Live #Now #WanitaManjaMasaKini #WanitaManjaIndonesia #WanitaManjaHarusKerjaKeras #WanitaManjaAntiJetlag #WanitaManjaHarusBahagia #WanitaManjaHarusSeringPiknik #WanitaManjaHarusBerkarya #WanitaManjaTidakBanyakBicaraTapiNyata #WanitaManjaTidakBolehLeyehLeyehManjaTapiPunyaCitraNyata #WanitaManjaTiadaAdaWaktuMikirinYangTakAdaFaedahApalagiMikirinOrangLain
work - princessyahrini - wanitamanjaantijetlag - sctvmusicawards2016 - wanitamanjaharuskerjakeras - now - wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata - wanitamanjatidakbanyakbicaratapinyata - wanitamanjaharusseringpiknik - wanitamanjamasakini - wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain - wanitamanjaindonesia - live - wanitamanjaharusbahagia - wanitamanjaharusberkarya - onduty -
royaljasmine146 : NIH RAHASIA PAYUDARA INDAH KAK JULIA PEREZ DAN NIKITA MIRZANI @HERBALOUTLET / KLIK : PIN.BBM.COM/2643C1A0.
rara.dwi08 : Wiih bener juga nih produk pemutih dari@dr.pauji.fashionherbal sekarang kulit aku tambah cerah :) makasih ya@dr.pauji.fashionherbal :)
royaljasmine148 : NIH RAHASIA PAYUDARA INDAH KAK JULIA PEREZ DAN NIKITA MIRZANI @HERBALOUTLET / KLIK : PIN.BBM.COM/2643C1A0.
titien_ishar : manjahhπŸ˜† @arieamirul baguus ya suaranya
program_bundahamil - icasungkar97 - resmaeneng - umaybakry46 -
instagram
princessyahrini - Syahrini
Duduk Manja Begitu Suasannaa ! #PrincesSyahrini #Work #Onduty #Paris_Maret2016 #Throwback #WanitaManjaMasaKini #WanitaManjaIndonesia #WanitaManjaHarusKerjaKeras #WanitaManjaAntiJetlag #WanitaManjaHarusBahagia #WanitaManjaHarusSeringPiknik #WanitaManjaHarusBerkarya #WanitaManjaTidakBanyakBicaraTapiNyata #WanitaManjaTidakBolehLeyehLeyehManjaTapiPunyaCitraNyata #WanitaManjaTiadaAdaWaktuMikirinYangTakAdaFaedahApalagiMikirinOrangLain
work - wanitamanjatidakbanyakbicaratapinyata - princessyahrini - wanitamanjaantijetlag - wanitamanjaharusseringpiknik - wanitamanjamasakini - wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain - wanitamanjaindonesia - wanitamanjaharuskerjakeras - wanitamanjaharusbahagia - wanitamanjaharusberkarya - throwback - onduty - wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata - paris_maret2016 -
program_bundahamil : SUDAH LAMA MENIKAH TAPI BELUM MENDAPAT KAN MOMONGAN .YUK KONSULTASI KAN KEPADA KAMI . Pin: 5D5E5C03. (konsul gratis).
royaljasmine146 : ALAT PEMBESAR PAYUDARA DALAM 20 HARI !!! DIJAMIN BESAR ! @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
rara.dwi08 : Wiih bener juga nih produk pemutih dari@dr.pauji.fashionherbal sekarang kulit aku tambah cerah :) makasih ya@dr.pauji.fashionherbal :)
royaljasmine148 : ALAT PEMBESAR PAYUDARA DALAM 20 HARI !!! DIJAMIN BESAR ! @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
marintanmdrts - gfwin51 - perdiyanthi - ochaoktafian -
instagram
princessyahrini - Syahrini
Kemanjaan Tadi Malam Bersama Para Lelaki Manja @gadiiing @glennfredly309 @dr_tompi ! #PrincesSyahrini #Work #Onduty #WanitaManjaMasaKini #WanitaManjaIndonesia #WanitaManjaHarusKerjaKeras #WanitaManjaAntiJetlag #WanitaManjaHarusBahagia #WanitaManjaHarusSeringPiknik #WanitaManjaHarusBerkarya #WanitaManjaTidakBanyakBicaraTapiNyata #WanitaManjaTidakBolehLeyehLeyehManjaTapiPunyaCitraNyata #WanitaManjaTiadaAdaWaktuMikirinYangTakAdaFaedahApalagiMikirinOrangLain
work - wanitamanjatidakbanyakbicaratapinyata - princessyahrini - wanitamanjaantijetlag - wanitamanjaharusseringpiknik - wanitamanjamasakini - wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain - wanitamanjaindonesia - wanitamanjaharuskerjakeras - wanitamanjaharusbahagia - wanitamanjaharusberkarya - onduty - wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata -
ayudia_j : Hari gini masih jerawatan 😌Kemana aja keles coba dulu dh masker ajaib dari@DR.HERBALBEAUTY dijamin ampuh bgt deh , πŸ‡­πŸ‡¦πŸ‡·πŸ‡¬πŸ‡¦ paling πŸ‡²πŸ‡ΊπŸ‡·πŸ‡¦πŸ‡­ atau bisa invite pin CS nya 21F0B5B9 , halal MUI djamin AMAN ada BPOM,
royaljasmine146 : PENGENCANG PAYUDARA DAN BOKONG KHASIAT DALAM 20 HARI , MENGGUNAKAN ALAT TEKNOLOGI CANGGIH VISIT IG HERE @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
rara.dwi08 : Luar biasa ka@princessyahrini produknya, padahal awalnya aku gak percaya kalo produk dari@dr.pauji.fashionherbal,bisa mutihin kulit aku, kini kulit ak jadi lebih putih ka ;)
royaljasmine148 : PENGENCANG PAYUDARA DAN BOKONG KHASIAT DALAM 20 HARI , MENGGUNAKAN ALAT TEKNOLOGI CANGGIH VISIT IG HERE @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
ithajuga - devifatmala247 - tha_kanterganti - susi3249 -
instagram
princessyahrini - Syahrini
Selalu Di Manjakan Oleh nya πŸ‘‰ @carendelano #Repost @carendelano with @repostapp. ・・・ She is like my Barbie doll.. She is open to any idea to make her look fabulous! Thank you Cantik @princessyahrini #headpiece by @rinaldyayunardi #hairdo by @hairstylist_arrusa back stage moment before Live with Trio Lestari. #carendeano #personalstylist #PrincesSyahrini #fashionstylist #fashionstyling #indonesiancelebrity #imakeyoulookfabulous
hairdo - imakeyoulookfabulous - carendeano - personalstylist - fashionstyling - princessyahrini - fashionstylist - indonesiancelebrity - headpiece - repost -
risalubisid : Hari gini masih jerawatan 😌Kemana aja keles coba dulu dh masker ajaib dari@DR.HERBALBEAUTY dijamin ampuh bgt deh , πŸ‡­πŸ‡¦πŸ‡·πŸ‡¬πŸ‡¦ paling πŸ‡²πŸ‡ΊπŸ‡·πŸ‡¦πŸ‡­ atau bisa invite pin CS nya 21F0B5B9 , halal MUI djamin AMAN ada BPOM,
royaljasmine141 : NIH AKU BONGKAR RAHASIA PUNYA PAYUDARA INDAH WINNY PUTRI @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
royaljasmine146 : NIH AKU BONGKAR RAHASIA PUNYA PAYUDARA INDAH WINNY PUTRI @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
royaljasmine148 : NIH AKU BONGKAR RAHASIA PUNYA PAYUDARA INDAH WINNY PUTRI @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
fachira.rmdhni - my52nameis - anaasilah - putricecylia_25 -
instagram
princessyahrini - Syahrini
About Last Nite πŸ‘‡πŸ‘‡πŸ‘‡ Personal stylist by @carendelano Dress by @hiantjen Headpiece by @rinaldyayunardi Hairdo by hairstylist_arrusa. #PrincesSyahrini #Onduty #Work #WanitaManjaMasaKini #WanitaManjaIndonesia #WanitaManjaHarusKerjaKeras #WanitaManjaAntiJetlag #WanitaManjaHarusBahagia #WanitaManjaHarusSeringPiknik #WanitaManjaHarusBerkarya #WanitaManjaTidakBanyakBicaraTapiNyata #WanitaManjaTidakBolehLeyehLeyehManjaTapiPunyaCitraNyata #WanitaManjaTiadaAdaWaktuMikirinYangTakAdaFaedahApalagiMikirinOrangLainp
work - wanitamanjatidakbanyakbicaratapinyata - princessyahrini - wanitamanjaantijetlag - wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglainp - wanitamanjaharusseringpiknik - wanitamanjamasakini - wanitamanjaindonesia - wanitamanjaharuskerjakeras - wanitamanjaharusbahagia - wanitamanjaharusberkarya - onduty - wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata -
risalubisid : Pemutih herbal terjamin kualitasnya & terbukti khasiatnya , πŸ‡­πŸ‡¦πŸ‡·πŸ‡¬πŸ‡¦ ter πŸ‡²πŸ‡ΊπŸ‡·πŸ‡¦πŸ‡­ info invite@DR.HERBALBEAUTY / 21F0B5B9 pin : 21F0B5B9 Whatsapp : 089689238892 , sudah dapet halal MUI & BPOM ,
royaljasmine141 : NIH AKU MAU REKOMEN BGT ALAT PEMBESAR PAYUDARA MBCA DARI @HERBALOUTLET SOALNYA SKRG PAYUDARA AKU JADI JAUH LEBIH KENCANG DAN PADET SKRG , KEREN BGT DEH KONSULTANNYA JG, KLO KAMU MAU ADD CP NYA KLIK: PIN.BBM.COM/2643C1A0.
royaljasmine146 : NIH AKU MAU REKOMEN BGT ALAT PEMBESAR PAYUDARA MBCA DARI @HERBALOUTLET SOALNYA SKRG PAYUDARA AKU JADI JAUH LEBIH KENCANG DAN PADET SKRG , KEREN BGT DEH KONSULTANNYA JG, KLO KAMU MAU ADD CP NYA KLIK: PIN.BBM.COM/2643C1A0.
royaljasmine148 : NIH AKU MAU REKOMEN BGT ALAT PEMBESAR PAYUDARA MBCA DARI @HERBALOUTLET SOALNYA SKRG PAYUDARA AKU JADI JAUH LEBIH KENCANG DAN PADET SKRG , KEREN BGT DEH KONSULTANNYA JG, KLO KAMU MAU ADD CP NYA KLIK: PIN.BBM.COM/2643C1A0.
thha_keciil - genovevasasenga - keysasalsabila - ainunhersilan -
instagram
princessyahrini - Syahrini
LIVE W/ Trio Lestari Manja @triolestari @transtv_corp ... Menyanyikan Lagu Manjanya @glennfredly309 Di Iringi Band Yang Begitu Nyata.... Dengan Balutan Keindahan Dress Manja by @hiantjen Headpiece Manja Dari Tangan Bertalenta by @rinaldyayunardi Disertai Syantieknya Tatanan Rambut Manja by @hairstylist_arrusa Tentunya Smua Kemanjaan Ini Atas Prakarsa Dan Prakarya Tangan Dinginnya Sang Personal Stylist @carendelano !!! #PrincesSyahrini #Work #Onduty #Live #Transtv #TrioLestari #WanitaManjaMasaKini #WanitaManjaIndonesia #WanitaManjaHarusKerjaKeras #WanitaManjaAntiJetlag #WanitaManjaHarusBahagia #WanitaManjaHarusSeringPiknik #WanitaManjaHarusBerkarya #WanitaManjaTidakBanyakBicaraTapiNyata #WanitaManjaTidakBolehLeyehLeyehManjaTapiPunyaCitraNyata #WanitaManjaTiadaAdaWaktuMikirinYangTakAdaFaedahApalagiMikirinOrangLain
princessyahrini - wanitamanjaantijetlag - wanitamanjamasakini - triolestari - wanitamanjaharuskerjakeras - transtv - wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata - wanitamanjatidakbanyakbicaratapinyata - wanitamanjaharusseringpiknik - work - wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain - wanitamanjaindonesia - live - wanitamanjaharusbahagia - wanitamanjaharusberkarya - onduty -
royaljasmine141 : NIH KEPOIN AJA RAHASIA PUNYA PAYUDARA INDAH KAYA ARTIS AURA KASIH @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
promo_spreikhanzaolshop : Yuuk kepoin sprei motif bs request uk suka kamu πŸ‘‰πŸ‘‰@spreikhanzaolshop
royaljasmine146 : NIH KEPOIN AJA RAHASIA PUNYA PAYUDARA INDAH KAYA ARTIS AURA KASIH @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
royaljasmine148 : NIH KEPOIN AJA RAHASIA PUNYA PAYUDARA INDAH KAYA ARTIS AURA KASIH @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
_triaana - lizaimoetz23 - iraafiqzu_12 - liliscaem_bgt -
instagram
princessyahrini - Syahrini
My favorite song by @glennfredly309 @dr_tompi I love to sing this song over and over again.. Tonight i have the privilege to sing this song LIVE at 8:30 PM in Trio Lestari @transtv_corp ! #PrincesSyahrini #Work #Onduty #LiveOnTransTv #Live #Tonight #WanitaManjaMasaKini #WanitaManjaIndonesia #WanitaManjaHarusKerjaKeras #WanitaManjaAntiJetlag #WanitaManjaHarusBahagia #WanitaManjaHarusSeringPiknik #WanitaManjaHarusBerkarya #WanitaManjaTidakBanyakBicaraTapiNyata #WanitaManjaTidakBolehLeyehLeyehManjaTapiPunyaCitraNyata #WanitaManjaTiadaAdaWaktuMikirinYangTakAdaFaedahApalagiMikirinOrangLain
work - princessyahrini - wanitamanjaantijetlag - tonight - liveontranstv - wanitamanjaharuskerjakeras - wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata - wanitamanjatidakbanyakbicaratapinyata - wanitamanjaharusseringpiknik - wanitamanjamasakini - wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain - wanitamanjaindonesia - live - wanitamanjaharusbahagia - wanitamanjaharusberkarya - onduty -
royaljasmine141 : KAK JUPE PUNYA PAYUDARA BAGUS GARA2 AKUN OLSHOP INI NIH @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
royaljasmine146 : KAK JUPE PUNYA PAYUDARA BAGUS GARA2 AKUN OLSHOP INI NIH @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
fitria_roma : Kakak,aku ngefans banget sama kaka,kaka tu cantik,lucu,imut dan segalanyalah pokoknya,tapi secantik apapun kaka,tetep aja aku gak bisa ketemu kaka,aku cuma bisa doain semoga kakak selalu sukses dan selalu menjadi inspirasi semua wanita indonesia,amin ya Allah
royaljasmine148 : KAK JUPE PUNYA PAYUDARA BAGUS GARA2 AKUN OLSHOP INI NIH @HERBALOUTLET KLIK : PIN.BBM.COM/2643C1A0.
nananajibahh - agnsstasya08 - cameliaf22 - citrajuarsyah -
instagram
princessyahrini - Syahrini
Vocalizing Before To Get On Stage @adele ! -----Backing Vocal Manja @nellycarey---- #PrincesSyahrini #Work #Onduty #WanitaManjaMasaKini #WanitaManjaIndonesia #WanitaManjaHarusKerjaKeras #WanitaManjaAntiJetlag #WanitaManjaHarusBahagia #WanitaManjaHarusSeringPiknik #WanitaManjaHarusBerkarya #WanitaManjaTidakBanyakBicaraTapiNyata #WanitaManjaTidakBolehLeyehLeyehManjaTapiPunyaCitraNyata #WanitaManjaTiadaAdaWaktuMikirinYangTakAdaFaedahApalagiMikirinOrangLain
work - wanitamanjatidakbanyakbicaratapinyata - princessyahrini - wanitamanjaantijetlag - wanitamanjaharusseringpiknik - wanitamanjamasakini - wanitamanjatiadaadawaktumikirinyangtakadafaedahapalagimikirinoranglain - wanitamanjaindonesia - wanitamanjaharuskerjakeras - wanitamanjaharusbahagia - wanitamanjaharusberkarya - onduty - wanitamanjatidakbolehleyehleyehmanjatapipunyacitranyata -
iviamarizki : ❀️❀️❀️❀️❀️❀️❀️
royaljasmine146 : PAYUDARA KECIL? MAU PUNYA SEINDAH KAK JUPE ATAU ARTIS-ARTIS LAINNYA? NIH KEPOIN AJAA @HERBALOUTLET MEREKA BELANJAA DISINIII KLIK: PIN.BBM.COM/2643C1A0.
kurnialusiyanti : @thessathess @rizkymiraa @ughi_u
royaljasmine148 : PAYUDARA KECIL? MAU PUNYA SEINDAH KAK JUPE ATAU ARTIS-ARTIS LAINNYA? NIH KEPOIN AJAA @HERBALOUTLET MEREKA BELANJAA DISINIII KLIK: PIN.BBM.COM/2643C1A0.
febriany_febriany - buburontheway - violita_2023 - syarifa_hida -
instagram
Iconosquare feedback